PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G065400.1
Common NamePHAVU_004G065400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 104aa    MW: 12090.7 Da    PI: 10.339
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G065400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.83.4e-102267348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rWT+ E+ l++ + +   +g+Wk+I+++    +t  q+ s+ qky+
  Phvul.004G065400.1 22 RWTENEHRLFLIGLQNCSPGDWKSISKRYIPSKTSTQIASHAQKYM 67
                        9*************************98877*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-81377IPR009057Homeodomain-like
PROSITE profilePS5129410.0551571IPR017930Myb domain
SuperFamilySSF466893.36E-141771IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-121867IPR006447Myb domain, plants
SMARTSM007170.00311969IPR001005SANT/Myb domain
CDDcd001679.32E-62267No hitNo description
PfamPF002499.0E-82266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MPNYLNHSTP PVSKSHHKRY ERWTENEHRL FLIGLQNCSP GDWKSISKRY IPSKTSTQIA  60
SHAQKYMHYQ NGLKKNKKRK SIHDVTLDDI NTSVVPSFIN QEQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151661.15e-73hypothetical protein PHAVU_004G065400g
TrEMBLV7C3085e-73V7C308_PHAVU; Uncharacterized protein
STRINGscaffold_600421.11e-22(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1852625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-26MYB family protein